![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H3 [47122] (6 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (41 PDB entries) |
![]() | Domain d2fj7a1: 2fj7 A:38-135 [133548] Other proteins in same PDB: d2fj7b1, d2fj7d1, d2fj7f1, d2fj7h1 automatically matched to d1p3ie_ protein/DNA complex |
PDB Entry: 2fj7 (more details), 3.2 Å
SCOPe Domain Sequences for d2fj7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fj7a1 a.22.1.1 (A:38-135) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]} phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease aylvalfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d2fj7a1: