Class a: All alpha proteins [46456] (290 folds) |
Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) |
Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
Protein Histone H4 [47125] (7 species) |
Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries) |
Domain d2fj7b1: 2fj7 B:24-102 [133549] Other proteins in same PDB: d2fj7a1, d2fj7d1, d2fj7e1, d2fj7h1 automatically matched to d1p3ob_ protein/DNA complex |
PDB Entry: 2fj7 (more details), 3.2 Å
SCOPe Domain Sequences for d2fj7b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fj7b1 a.22.1.1 (B:24-102) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta mdvvyalkrqgrtlygfgg
Timeline for d2fj7b1: