Lineage for d2fj7e1 (2fj7 E:38-135)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698296Protein Histone H3 [47122] (6 species)
  7. 2698297Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (41 PDB entries)
  8. 2698372Domain d2fj7e1: 2fj7 E:38-135 [133551]
    Other proteins in same PDB: d2fj7b1, d2fj7d1, d2fj7f1, d2fj7h1
    automatically matched to d1p3ie_
    protein/DNA complex

Details for d2fj7e1

PDB Entry: 2fj7 (more details), 3.2 Å

PDB Description: crystal structure of nucleosome core particle containing a poly (da.dt) sequence element
PDB Compounds: (E:) histone h3

SCOPe Domain Sequences for d2fj7e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fj7e1 a.22.1.1 (E:38-135) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvalfedtnlcaihakrvtimpkdiqlarrirgera

SCOPe Domain Coordinates for d2fj7e1:

Click to download the PDB-style file with coordinates for d2fj7e1.
(The format of our PDB-style files is described here.)

Timeline for d2fj7e1: