Lineage for d2f8ng_ (2f8n G:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2698054Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 2698055Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 2698056Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 2698673Protein macro-H2A.1, histone domain [140396] (1 species)
  7. 2698674Species Human (Homo sapiens) [TaxId:9606] [140397] (2 PDB entries)
    Uniprot O75367 11-116
  8. 2698675Domain d2f8ng_: 2f8n G: [133138]
    Other proteins in same PDB: d2f8na_, d2f8nb_, d2f8nd_, d2f8ne_, d2f8nf_, d2f8nh_, d2f8nk1
    automated match to d1u35c1
    protein/DNA complex

Details for d2f8ng_

PDB Entry: 2f8n (more details), 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes
PDB Compounds: (G:) Core histone macro-H2A.1

SCOPe Domain Sequences for d2f8ng_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f8ng_ a.22.1.1 (G:) macro-H2A.1, histone domain {Human (Homo sapiens) [TaxId: 9606]}
stktsrsakagvifpvgrmlryikkghpkyrigvgapvymaavleyltaeilelavnaar
dnkkgrvtprhillavandeelnqllkgvtiasggvlpnihpellakk

SCOPe Domain Coordinates for d2f8ng_:

Click to download the PDB-style file with coordinates for d2f8ng_.
(The format of our PDB-style files is described here.)

Timeline for d2f8ng_: