![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
![]() | Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
![]() | Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
![]() | Protein Histone H4 [47125] (7 species) |
![]() | Species African clawed frog (Xenopus laevis) [TaxId:8355] [47127] (45 PDB entries) |
![]() | Domain d2f8nb_: 2f8n B: [133134] Other proteins in same PDB: d2f8na_, d2f8nd_, d2f8ne_, d2f8ng_, d2f8nh_, d2f8nk1 automated match to d1kx5b_ protein/DNA complex |
PDB Entry: 2f8n (more details), 2.9 Å
SCOPe Domain Sequences for d2f8nb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8nb_ a.22.1.1 (B:) Histone H4 {African clawed frog (Xenopus laevis) [TaxId: 8355]} dniqgitkpairrlarrggvkrisgliyeetrgvlkvflenvirdavtytehakrktvta mdvvyalkrqgrtlygfgg
Timeline for d2f8nb_: