SCOPe 2.08: Domain d2f8nd_: 2f8n D:

Lineage for d2f8nd_ (2f8n D:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (5 families)

5. Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
   form octamers composed of two copies of each of the four histones

6. Protein Histone H2B [47119] (6 species)

7. Species Mouse (Mus musculus), H2Ba [TaxId:10090] [140393] (2 PDB entries)
   Uniprot Q9D2U9 34-126

8. Domain d2f8nd_: 2f8n D: [133135]
   Other proteins in same PDB: d2f8na_, d2f8nb_, d2f8ne_, d2f8nf_, d2f8ng_, d2f8nk1
   automated match to d1kx5d_
   protein/DNA complex

Details for d2f8nd_

PDB Entry: 2f8n, 2.9 Å

PDB Description: 2.9 Angstrom X-ray structure of hybrid macroH2A nucleosomes

PDB Compounds: (D:) Histone 3, H2ba

SCOPe Domain Sequences for d2f8nd_:

Sequence; same for both SEQRES and ATOM records:

>d2f8nd_ a.22.1.1 (D:) Histone H2B {Mouse (Mus musculus), H2Ba [TaxId: 10090]}
rkesysiyvykvlkqvhpdtgisskamgimnsfvndiferiaseasrlahynkrstitsr
evqtavrlllpgelakhavsegtkavtkytssk

Timeline for d2f8nd_:

• d2f8nd_ first appeared in SCOP 1.73, called d2f8nd1
  
• d2f8nd_ appears in SCOPe 2.07