| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.22: Histone-fold [47112] (1 superfamily) core: 3 helices; long middle helix is flanked at each end with shorter ones |
Superfamily a.22.1: Histone-fold [47113] (5 families) ![]() |
| Family a.22.1.1: Nucleosome core histones [47114] (6 proteins) form octamers composed of two copies of each of the four histones |
| Protein Histone H3 [47122] (6 species) |
| Species African clawed frog (Xenopus laevis) [TaxId:8355] [47124] (41 PDB entries) |
| Domain d2f8na_: 2f8n A: [133133] Other proteins in same PDB: d2f8nb_, d2f8nd_, d2f8nf_, d2f8ng_, d2f8nh_, d2f8nk1 automated match to d1kx5a_ protein/DNA complex |
PDB Entry: 2f8n (more details), 2.9 Å
SCOPe Domain Sequences for d2f8na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8na_ a.22.1.1 (A:) Histone H3 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
phryrpgtvalreirryqkstellirklpfqrlvreiaqdfktdlrfqssavmalqease
aylvglfedtnlcaihakrvtimpkdiqlarrirgera
Timeline for d2f8na_: