SCOPe 2.08: Domain d2e74d2: 2e74 D:9-45

Lineage for d2e74d2 (2e74 D:9-45)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.0: automated matches [254198] (1 protein)
   not a true family

6. Protein automated matches [254432] (4 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [255131] (4 PDB entries)

8. Domain d2e74d2: 2e74 D:9-45 [132050]
   Other proteins in same PDB: d2e74a_, d2e74b1, d2e74d1, d2e74e1, d2e74f_, d2e74g_, d2e74h_
   automated match to d2e74d2
   complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74d2

PDB Entry: 2e74, 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus

PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d2e74d2:

Sequence; same for both SEQRES and ATOM records:

>d2e74d2 f.23.12.0 (D:9-45) automated matches {Mastigocladus laminosus [TaxId: 83541]}
dvpdmgrrqfmnllafgtvtgvalgalyplvkyfipp

Timeline for d2e74d2:

• d2e74d2 first appeared in SCOP 1.73
  
• d2e74d2 appears in SCOPe 2.07