SCOPe 2.08: Domain d2e74a_: 2e74 A:

Lineage for d2e74a_ (2e74 A:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [196844] (6 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [196845] (5 PDB entries)

8. Domain d2e74a_: 2e74 A: [132048]
   Other proteins in same PDB: d2e74b1, d2e74d1, d2e74d2, d2e74e1, d2e74f_, d2e74g_, d2e74h_
   automated match to d4i7za_
   complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74a_

PDB Entry: 2e74, 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus

PDB Compounds: (A:) Cytochrome b6

SCOPe Domain Sequences for d2e74a_:

Sequence; same for both SEQRES and ATOM records:

>d2e74a_ f.21.1.2 (A:) automated matches {Mastigocladus laminosus [TaxId: 83541]}
manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
tryysahtfvlpwliavfmllhflmirkqgisgpl

Timeline for d2e74a_:

• d2e74a_ first appeared in SCOP 1.73, called d2e74a1
  
• d2e74a_ appears in SCOPe 2.07