![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) ![]() |
![]() | Family f.23.12.0: automated matches [254198] (1 protein) not a true family |
![]() | Protein automated matches [254432] (4 species) not a true protein |
![]() | Species Mastigocladus laminosus [TaxId:83541] [255131] (4 PDB entries) |
![]() | Domain d2e74d2: 2e74 D:9-45 [132050] Other proteins in same PDB: d2e74a_, d2e74b1, d2e74d1, d2e74e1, d2e74f_, d2e74g_, d2e74h_ automated match to d2e74d2 complexed with bcr, cd, cla, fes, hem, opc, sqd, umq |
PDB Entry: 2e74 (more details), 3 Å
SCOPe Domain Sequences for d2e74d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2e74d2 f.23.12.0 (D:9-45) automated matches {Mastigocladus laminosus [TaxId: 83541]} dvpdmgrrqfmnllafgtvtgvalgalyplvkyfipp
Timeline for d2e74d2: