PDB entry 2e74

View 2e74 on RCSB PDB site
Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus
Class: photosynthesis
Keywords: photosynthesis, cytochrome F, rieske iron-sulfur protein, HEME CN
Deposited on 2007-01-05, released 2007-06-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.225
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cytochrome b6
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e74a_
  • Chain 'B':
    Compound: Cytochrome b6-f complex subunit 4
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e74b1
  • Chain 'C':
    Compound: Apocytochrome f
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Cytochrome b6-f complex iron-sulfur subunit
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e74d1, d2e74d2
  • Chain 'E':
    Compound: Cytochrome b6-f complex subunit 6
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e74e1
  • Chain 'F':
    Compound: Cytochrome b6-f complex subunit 7
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e74f_
  • Chain 'G':
    Compound: Cytochrome b6-f complex subunit 5
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e74g_
  • Chain 'H':
    Compound: Cytochrome b6-f complex subunit 8
    Species: Mastigocladus laminosus [TaxId:83541]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2e74h_
  • Heterogens: CD, HEM, UMQ, CLA, OPC, FES, SQD, BCR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e74A (A:)
    manvydwfqerleiqaladdvtskyvpphvnifyclggitltcfliqfatgfamtfyykp
    tvteayasvqyimnevsfgwlirsihrwsasmmvlmmilhvfrvyltggfkkpreltwis
    gvilavitvsfgvtgyslpwdqvgywavkivsgvpeaipvvgvlisdllrggssvgqatl
    tryysahtfvlpwliavfmllhflmirkqgisgpl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e74B (B:)
    matlkkpdlsdpklraklakgmghnyygepawpndllyvfpvvimgtfacivalsvldpa
    mvgepadpfatpleilpewylypvfqilrsvpnkllgvllmasvplglilvpfienvnkf
    qnpfrrpvattiflfgtlvtiwlgigatfpldktltlglf
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2e74D (D:)
    maqftesmdvpdmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdkl
    gnnvkvskfleshnagdrvlvqglkgdptyivveskeairdyginavcthlgcvvpwnaa
    enkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e74D (D:)
    dvpdmgrrqfmnllafgtvtgvalgalyplvkyfippsggavgggttakdklgnnvkvsk
    fleshnagdrvlvqglkgdptyivairdyginavcthlgcvvpwnaaenkfkcpchgsqy
    detgkvirgpaplslalchatvqddnivltpwtetdfrtgekpwwv
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e74E (E:)
    milgavfyivfialffgiavgiifaiksikli
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2e74F (F:)
    mteemlyaallsfglifvgwglgvlllkiqgaeke
    

    Sequence, based on observed residues (ATOM records): (download)
    >2e74F (F:)
    mteemlyaallsfglifvgwglgvlllkiqga
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e74G (G:)
    mveplldglvlglvfatlgglfyaayqqykrpnelgg
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2e74H (H:)
    meidvlgwvallvvftwsiamvvwgrngl