SCOPe 2.08: Domain d2e74d1: 2e74 D:46-179

Lineage for d2e74d1 (2e74 D:46-179)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (9 proteins)

6. Protein automated matches [190874] (7 species)
   not a true protein

7. Species Mastigocladus laminosus [TaxId:83541] [255132] (4 PDB entries)

8. Domain d2e74d1: 2e74 D:46-179 [132049]
   Other proteins in same PDB: d2e74a_, d2e74b1, d2e74d2, d2e74e1, d2e74f_, d2e74g_, d2e74h_
   automated match to d1vf5d1
   complexed with bcr, cd, cla, fes, hem, opc, sqd, umq

Details for d2e74d1

PDB Entry: 2e74, 3 Å

PDB Description: Crystal Structure of the Cytochrome b6f Complex from M.laminosus

PDB Compounds: (D:) Cytochrome b6-f complex iron-sulfur subunit

SCOPe Domain Sequences for d2e74d1:

Sequence, based on SEQRES records:

>d2e74d1 b.33.1.1 (D:46-179) automated matches {Mastigocladus laminosus [TaxId: 83541]}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivveskeairdygin
avcthlgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpw
tetdfrtgekpwwv

Sequence, based on observed residues (ATOM records):

>d2e74d1 b.33.1.1 (D:46-179) automated matches {Mastigocladus laminosus [TaxId: 83541]}
sggavgggttakdklgnnvkvskfleshnagdrvlvqglkgdptyivairdyginavcth
lgcvvpwnaaenkfkcpchgsqydetgkvirgpaplslalchatvqddnivltpwtetdf
rtgekpwwv

Timeline for d2e74d1:

• d2e74d1 first appeared in SCOP 1.73
  
• d2e74d1 appears in SCOPe 2.07