Lineage for d2d6fc1 (2d6f C:445-503)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736065Fold a.182: GatB/YqeY motif [89094] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles (4-helical and 3-helical)
  4. 2736066Superfamily a.182.1: GatB/YqeY motif [89095] (2 families) (S)
  5. 2736071Family a.182.1.2: GatB/GatE C-terminal domain-like [140757] (2 proteins)
    assigned to the same Pfam PF02637 family as YeqY by the presence of a common sequence motif with an alpha-hairpin structure
  6. 2736079Protein Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain [140760] (2 species)
  7. 2736080Species Methanobacterium thermoautotrophicum [TaxId:145262] [140761] (1 PDB entry)
    Uniprot O26803 445-503
  8. 2736081Domain d2d6fc1: 2d6f C:445-503 [131307]
    Other proteins in same PDB: d2d6fa1, d2d6fa2, d2d6fb1, d2d6fb2, d2d6fc2, d2d6fc3, d2d6fd2, d2d6fd3
    protein/RNA complex; complexed with zn

Details for d2d6fc1

PDB Entry: 2d6f (more details), 3.15 Å

PDB Description: Crystal structure of Glu-tRNA(Gln) amidotransferase in the complex with tRNA(Gln)
PDB Compounds: (C:) Glutamyl-tRNA(Gln) amidotransferase subunit E

SCOPe Domain Sequences for d2d6fc1:

Sequence, based on SEQRES records: (download)

>d2d6fc1 a.182.1.2 (C:445-503) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
elpsekkerimrdyglsedlasqlvkrnlvdefealtefrvdttviasllaytlrelrr

Sequence, based on observed residues (ATOM records): (download)

>d2d6fc1 a.182.1.2 (C:445-503) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
elpsekkerimrdyglsedlasqlvkrnlvdefdttviasllaytlrelrr

SCOPe Domain Coordinates for d2d6fc1:

Click to download the PDB-style file with coordinates for d2d6fc1.
(The format of our PDB-style files is described here.)

Timeline for d2d6fc1: