Lineage for d2d6fc3 (2d6f C:1-270,C:396-444)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538574Family d.128.1.5: GatB/GatE catalytic domain-like [143812] (2 proteins)
    N-terminal and C-terminal parts correspond to Pfam PF02934 (GatB_N) and Pfam PF01162 (GatB), respectively
  6. 2538582Protein Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE [143815] (2 species)
  7. 2538583Species Methanobacterium thermoautotrophicum [TaxId:145262] [143816] (1 PDB entry)
    Uniprot O26803 1-270,396-444
  8. 2538584Domain d2d6fc3: 2d6f C:1-270,C:396-444 [131309]
    Other proteins in same PDB: d2d6fa1, d2d6fa2, d2d6fb1, d2d6fb2, d2d6fc1, d2d6fc2, d2d6fd1, d2d6fd2
    protein/RNA complex; complexed with zn

Details for d2d6fc3

PDB Entry: 2d6f (more details), 3.15 Å

PDB Description: Crystal structure of Glu-tRNA(Gln) amidotransferase in the complex with tRNA(Gln)
PDB Compounds: (C:) Glutamyl-tRNA(Gln) amidotransferase subunit E

SCOPe Domain Sequences for d2d6fc3:

Sequence, based on SEQRES records: (download)

>d2d6fc3 d.128.1.5 (C:1-270,C:396-444) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mdwekvglkmgleihqqldtesklfcpcrteltdsepdhdivrnlrptqselgkfdraaf
eeamrklhfhyenyheetclveadeepphplnpealeiavtialllnmrvvdefhtmrkq
vidgsntggfqrtglvatdghletpqgtvkienlcleedaarriretgdgvvfrldrlgi
plveittdpsmsdpqqlrevayqigqilrstrvkrglgtirqdlnisirdgarvevkgvq
dldlipeiverevkrqlslveirdtlqergXpeetrkalpdgntqylrplptssrmylet
diplfrieddllegirrnlp

Sequence, based on observed residues (ATOM records): (download)

>d2d6fc3 d.128.1.5 (C:1-270,C:396-444) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mdwekvglkmgleihqqldtesklfcpcrteltdsepdhdivrnlrptafeeamrklhfh
yenyheetclveadeepphplnpealeiavtialllnmrvvdefhtmrkqvidgsntggf
qrtglvatdghletpqgtvkienlcleedaarriretgdgvvfrldrlgiplveittdps
msdpqqlrevayqigqilrstrvkrglgtirqdlnisirdgarvevkgvqdldlipeive
revkrqlslveirdtlqergXpeetrkalpdgntqylrplptssrmyletdiplfriedd
llegirrnlp

SCOPe Domain Coordinates for d2d6fc3:

Click to download the PDB-style file with coordinates for d2d6fc3.
(The format of our PDB-style files is described here.)

Timeline for d2d6fc3: