SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2d6fa2 (2d6f A:84-435)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142702Protein Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD [142776] (2 species)
  7. 2142703Species Methanobacterium thermoautotrophicum [TaxId:145262] [142778] (1 PDB entry)
    Uniprot O26802 84-435
  8. 2142704Domain d2d6fa2: 2d6f A:84-435 [131304]
    Other proteins in same PDB: d2d6fa1, d2d6fb1, d2d6fb2, d2d6fc1, d2d6fc2, d2d6fc3, d2d6fd1, d2d6fd2, d2d6fd3
    protein/RNA complex; complexed with zn

Details for d2d6fa2

PDB Entry: 2d6f (more details), 3.15 Å

PDB Description: Crystal structure of Glu-tRNA(Gln) amidotransferase in the complex with tRNA(Gln)
PDB Compounds: (A:) Glutamyl-tRNA(Gln) amidotransferase subunit D

SCOPe Domain Sequences for d2d6fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d6fa2 c.88.1.1 (A:84-435) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]}
aaedpelpdvsiistggtvasiidyrtgavhpaftaddllranpelldianirgravfni
lsenmkpeywvetaravygeikdgadgvvvahgtdtmhytsaalsfmlrtpvpvvftgaq
rssdrpssdaslniqcsvraatseiaevtvcmhatmddlschlhrgvkvrkmhtsrrdtf
rsmnalplaevtpdgikileenyrkrgsdelelsdrveervafiksypgispdiikwhld
egyrgiviegtglghcpdtlipvigeahdmgvpvamtsqclngrvnmnvystgrrllqag
vipcddmlpevayvkmcwvlgqtddpemaremmreniageinertsiayfrg

SCOPe Domain Coordinates for d2d6fa2:

Click to download the PDB-style file with coordinates for d2d6fa2.
(The format of our PDB-style files is described here.)

Timeline for d2d6fa2: