SCOPe 2.08: Domain d2d6fb1: 2d6f B:2-73

Lineage for d2d6fb1 (2d6f B:2-73)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.3: GatD N-terminal domain-like [141300] (2 families)

5. Family b.38.3.0: automated matches [254224] (1 protein)
   not a true family
6. Protein automated matches [254507] (1 species)
   not a true protein
7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [255109] (1 PDB entry)

8. Domain d2d6fb1: 2d6f B:2-73 [131305]
   Other proteins in same PDB: d2d6fa1, d2d6fa2, d2d6fb2, d2d6fc1, d2d6fc2, d2d6fc3, d2d6fd1, d2d6fd2, d2d6fd3
   automated match to d2d6fa1
   protein/RNA complex; complexed with zn

Details for d2d6fb1

PDB Entry: 2d6f, 3.15 Å

PDB Description: Crystal structure of Glu-tRNA(Gln) amidotransferase in the complex with tRNA(Gln)

PDB Compounds: (B:) Glutamyl-tRNA(Gln) amidotransferase subunit D

SCOPe Domain Sequences for d2d6fb1:

Sequence; same for both SEQRES and ATOM records:

>d2d6fb1 b.38.3.0 (B:2-73) automated matches {Methanothermobacter thermautotrophicus [TaxId: 145262]}
syqgrarkflesasidvgdmvlvekpdvtyegmvldraddaddrhivlklengynigvei
sdariellekgs

Timeline for d2d6fb1:

• d2d6fb1 first appeared in SCOP 1.73
  
• d2d6fb1 appears in SCOPe 2.07