| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.182: GatB/YqeY motif [89094] (1 superfamily) multihelical; consists of two different alpha-helical bundles (4-helical and 3-helical) |
Superfamily a.182.1: GatB/YqeY motif [89095] (2 families) ![]() |
| Family a.182.1.2: GatB/GatE C-terminal domain-like [140757] (2 proteins) assigned to the same Pfam PF02637 family as YeqY by the presence of a common sequence motif with an alpha-hairpin structure |
| Protein Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain [140760] (2 species) |
| Species Methanobacterium thermoautotrophicum [TaxId:145262] [140761] (1 PDB entry) Uniprot O26803 445-503 |
| Domain d2d6fd1: 2d6f D:445-503 [131310] Other proteins in same PDB: d2d6fa1, d2d6fa2, d2d6fb1, d2d6fb2, d2d6fc2, d2d6fc3, d2d6fd2, d2d6fd3 automatically matched to 2D6F C:445-503 protein/RNA complex; complexed with zn |
PDB Entry: 2d6f (more details), 3.15 Å
SCOPe Domain Sequences for d2d6fd1:
Sequence, based on SEQRES records: (download)
>d2d6fd1 a.182.1.2 (D:445-503) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
elpsekkerimrdyglsedlasqlvkrnlvdefealtefrvdttviasllaytlrelrr
>d2d6fd1 a.182.1.2 (D:445-503) Glutamyl-tRNA(Gln) amidotransferase subunit E, GatE, C-terminal domain {Methanobacterium thermoautotrophicum [TaxId: 145262]}
elpsekkerimrdyglsedlasqlvkrnlvdefdttviasllaytlrelrr
Timeline for d2d6fd1: