PDB entry 2d6f

View 2d6f on RCSB PDB site
Description: Crystal structure of Glu-tRNA(Gln) amidotransferase in the complex with tRNA(Gln)
Class: ligase/RNA
Keywords: ligase, RNA, ligase/RNA COMPLEX
Deposited on 2005-11-13, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.23
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamyl-tRNA(Gln) amidotransferase subunit D
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d6fa1, d2d6fa2
  • Chain 'B':
    Compound: Glutamyl-tRNA(Gln) amidotransferase subunit D
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d6fb1, d2d6fb2
  • Chain 'C':
    Compound: Glutamyl-tRNA(Gln) amidotransferase subunit E
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d6fc1, d2d6fc2, d2d6fc3
  • Chain 'D':
    Compound: Glutamyl-tRNA(Gln) amidotransferase subunit E
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2d6fd1, d2d6fd2, d2d6fd3
  • Chain 'E':
    Compound: tRNA
  • Chain 'F':
    Compound: tRNA
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2d6fA (A:)
    msyqgrarkflesasidvgdmvlvekpdvtyegmvldraddaddrhivlklengynigve
    isdariellekgseprielppveaaedpelpdvsiistggtvasiidyrtgavhpaftad
    dllranpelldianirgravfnilsenmkpeywvetaravygeikdgadgvvvahgtdtm
    hytsaalsfmlrtpvpvvftgaqrssdrpssdaslniqcsvraatseiaevtvcmhatmd
    dlschlhrgvkvrkmhtsrrdtfrsmnalplaevtpdgikileenyrkrgsdelelsdrv
    eervafiksypgispdiikwhldegyrgiviegtglghcpdtlipvigeahdmgvpvamt
    sqclngrvnmnvystgrrllqagvipcddmlpevayvkmcwvlgqtddpemaremmreni
    ageinertsiayfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d6fA (A:)
    syqgrarkflesasidvgdmvlvekpdvtyegmvldraddaddrhivlklengynigvei
    sdariellekgsaaedpelpdvsiistggtvasiidyrtgavhpaftaddllranpelld
    ianirgravfnilsenmkpeywvetaravygeikdgadgvvvahgtdtmhytsaalsfml
    rtpvpvvftgaqrssdrpssdaslniqcsvraatseiaevtvcmhatmddlschlhrgvk
    vrkmhtsrrdtfrsmnalplaevtpdgikileenyrkrgsdelelsdrveervafiksyp
    gispdiikwhldegyrgiviegtglghcpdtlipvigeahdmgvpvamtsqclngrvnmn
    vystgrrllqagvipcddmlpevayvkmcwvlgqtddpemaremmreniageinertsia
    yfrg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2d6fB (B:)
    msyqgrarkflesasidvgdmvlvekpdvtyegmvldraddaddrhivlklengynigve
    isdariellekgseprielppveaaedpelpdvsiistggtvasiidyrtgavhpaftad
    dllranpelldianirgravfnilsenmkpeywvetaravygeikdgadgvvvahgtdtm
    hytsaalsfmlrtpvpvvftgaqrssdrpssdaslniqcsvraatseiaevtvcmhatmd
    dlschlhrgvkvrkmhtsrrdtfrsmnalplaevtpdgikileenyrkrgsdelelsdrv
    eervafiksypgispdiikwhldegyrgiviegtglghcpdtlipvigeahdmgvpvamt
    sqclngrvnmnvystgrrllqagvipcddmlpevayvkmcwvlgqtddpemaremmreni
    ageinertsiayfrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d6fB (B:)
    syqgrarkflesasidvgdmvlvekpdvtyegmvldraddaddrhivlklengynigvei
    sdariellekgsepedpelpdvsiistggtvasiidyrtgavhpaftaddllranpelld
    ianirgravfnilsenmkpeywvetaravygeikdgadgvvvahgtdtmhytsaalsfml
    rtpvpvvftgaqrssdrpssdaslniqcsvraatseiaevtvcmhatmddlschlhrgvk
    vrkmhtsrrdtfrsmnalplaevtpdgikileenyrkrgsdelelsdrveervafiksyp
    gispdiikwhldegyrgiviegtglghcpdtlipvigeahdmgvpvamtsqclngrvnmn
    vystgrrllqagvipcddmlpevayvkmcwvlgqtddpemaremmreniageinertsia
    yfrg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2d6fC (C:)
    mdwekvglkmgleihqqldtesklfcpcrteltdsepdhdivrnlrptqselgkfdraaf
    eeamrklhfhyenyheetclveadeepphplnpealeiavtialllnmrvvdefhtmrkq
    vidgsntggfqrtglvatdghletpqgtvkienlcleedaarriretgdgvvfrldrlgi
    plveittdpsmsdpqqlrevayqigqilrstrvkrglgtirqdlnisirdgarvevkgvq
    dldlipeiverevkrqlslveirdtlqergavvedkifdvsevfadtesriissaesvla
    vklrgfdgligveiqpgrrlgtemadyakkrgvsgifhtdelpaygiteeevrglrdavg
    asqgdavvmvahervtaenalrevirraemaiqgvpeetrkalpdgntqylrplptssrm
    yletdiplfrieddllegirrnlpelpsekkerimrdyglsedlasqlvkrnlvdefeal
    tefrvdttviasllaytlrelrreghdvdglgldelrdaikllevgkiskdalrdivacm
    adeglaaedaarklnllllaedeiesiiqeivegnldmisergmgamgplmgqamgrlrg
    radgkvvnrilrekiqerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d6fC (C:)
    mdwekvglkmgleihqqldtesklfcpcrteltdsepdhdivrnlrptafeeamrklhfh
    yenyheetclveadeepphplnpealeiavtialllnmrvvdefhtmrkqvidgsntggf
    qrtglvatdghletpqgtvkienlcleedaarriretgdgvvfrldrlgiplveittdps
    msdpqqlrevayqigqilrstrvkrglgtirqdlnisirdgarvevkgvqdldlipeive
    revkrqlslveirdtlqergavvedkifdvsevfadtesriissaesvlavklrgfdgli
    gveiqpgrrlgtemadyakkrgvsgifhtdelpaygiteeevrglrdavgasqgdavvmv
    ahervtaenalrevirraemaiqgvpeetrkalpdgntqylrplptssrmyletdiplfr
    ieddllegirrnlpelpsekkerimrdyglsedlasqlvkrnlvdefdttviasllaytl
    relrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2d6fD (D:)
    mdwekvglkmgleihqqldtesklfcpcrteltdsepdhdivrnlrptqselgkfdraaf
    eeamrklhfhyenyheetclveadeepphplnpealeiavtialllnmrvvdefhtmrkq
    vidgsntggfqrtglvatdghletpqgtvkienlcleedaarriretgdgvvfrldrlgi
    plveittdpsmsdpqqlrevayqigqilrstrvkrglgtirqdlnisirdgarvevkgvq
    dldlipeiverevkrqlslveirdtlqergavvedkifdvsevfadtesriissaesvla
    vklrgfdgligveiqpgrrlgtemadyakkrgvsgifhtdelpaygiteeevrglrdavg
    asqgdavvmvahervtaenalrevirraemaiqgvpeetrkalpdgntqylrplptssrm
    yletdiplfrieddllegirrnlpelpsekkerimrdyglsedlasqlvkrnlvdefeal
    tefrvdttviasllaytlrelrreghdvdglgldelrdaikllevgkiskdalrdivacm
    adeglaaedaarklnllllaedeiesiiqeivegnldmisergmgamgplmgqamgrlrg
    radgkvvnrilrekiqerl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2d6fD (D:)
    mdwekvglkmgleihqqldtesklfcpcrteltdsepdhdivrnlrptraafeeamrklh
    fhyenyheetclveadeepphplnpealeiavtialllnmrvvdefhtmrkqvidgsntg
    gfqrtglvatdghletpqgtvkienlcleedaarriretgdgvvfrldrlgiplveittd
    psmsdpqqlrevayqigqilrstrvkrglgtirqdlnisirdgarvevkgvqdldlipei
    verevkrqlslveirdtlqergavvedkifdvsevfadtesriissaesvlavklrgfdg
    ligveiqpgrrlgtemadyakkrgvsgifhtdelpaygiteeevrglrdavgasqgdavv
    mvahervtaenalrevirraemaiqgvpeetrkalpdgntqylrplptssrmyletdipl
    frieddllegirrnlpelpsekkerimrdyglsedlasqlvkrnlvdefdttviasllay
    tlrelrreghdvdglgldelrdaikllevgkiskdalrdiva
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.