Lineage for d2d10b1 (2d10 B:88-198)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697426Fold a.11: Acyl-CoA binding protein-like [47026] (2 superfamilies)
    core: 3 helices; bundle, closed, left-handed twist; up-and-down
  4. 2697469Superfamily a.11.2: Second domain of FERM [47031] (2 families) (S)
    automatically mapped to Pfam PF00373
  5. 2697470Family a.11.2.1: Second domain of FERM [47032] (9 proteins)
  6. 2697500Protein Radixin [47035] (1 species)
  7. 2697501Species Mouse (Mus musculus) [TaxId:10090] [47036] (9 PDB entries)
  8. 2697505Domain d2d10b1: 2d10 B:88-198 [131100]
    Other proteins in same PDB: d2d10a2, d2d10a3, d2d10b2, d2d10b3, d2d10c2, d2d10c3, d2d10d2, d2d10d3
    automatically matched to d1gc6a1

Details for d2d10b1

PDB Entry: 2d10 (more details), 2.5 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NHERF-1 C-terminal tail peptide
PDB Compounds: (B:) Radixin

SCOPe Domain Sequences for d2d10b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d10b1 a.11.2.1 (B:88-198) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
dvseeliqeitqrlfflqvkeailndeiycppetavllasyavqakygdynkeihkpgyl
andrllpqrvleqhkltkeqweeriqnwheehrgmlredsmmeylkiaqdl

SCOPe Domain Coordinates for d2d10b1:

Click to download the PDB-style file with coordinates for d2d10b1.
(The format of our PDB-style files is described here.)

Timeline for d2d10b1: