Lineage for d2d10c2 (2d10 C:199-297)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803543Family b.55.1.5: Third domain of FERM [50776] (8 proteins)
  6. 2803573Protein Radixin [50779] (1 species)
  7. 2803574Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries)
  8. 2803579Domain d2d10c2: 2d10 C:199-297 [131104]
    Other proteins in same PDB: d2d10a1, d2d10a3, d2d10b1, d2d10b3, d2d10c1, d2d10c3, d2d10d1, d2d10d3
    automatically matched to d1gc6a2

Details for d2d10c2

PDB Entry: 2d10 (more details), 2.5 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NHERF-1 C-terminal tail peptide
PDB Compounds: (C:) Radixin

SCOPe Domain Sequences for d2d10c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d10c2 b.55.1.5 (C:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp

SCOPe Domain Coordinates for d2d10c2:

Click to download the PDB-style file with coordinates for d2d10c2.
(The format of our PDB-style files is described here.)

Timeline for d2d10c2: