![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (11 families) ![]() |
![]() | Family d.15.1.4: First domain of FERM [54256] (6 proteins) |
![]() | Protein Radixin [54259] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [54260] (9 PDB entries) |
![]() | Domain d2d10c3: 2d10 C:3-87 [131105] Other proteins in same PDB: d2d10a1, d2d10a2, d2d10b1, d2d10b2, d2d10c1, d2d10c2, d2d10d1, d2d10d2 automatically matched to d1gc6a3 |
PDB Entry: 2d10 (more details), 2.5 Å
SCOPe Domain Sequences for d2d10c3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d10c3 d.15.1.4 (C:3-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]} kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln kkvtqqdvkkenplqfkfrakffpe
Timeline for d2d10c3: