Lineage for d2d10d3 (2d10 D:3-87)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2932854Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 2932884Protein Radixin [54259] (1 species)
  7. 2932885Species Mouse (Mus musculus) [TaxId:10090] [54260] (9 PDB entries)
  8. 2932891Domain d2d10d3: 2d10 D:3-87 [131108]
    Other proteins in same PDB: d2d10a1, d2d10a2, d2d10b1, d2d10b2, d2d10c1, d2d10c2, d2d10d1, d2d10d2
    automatically matched to d1gc6a3

Details for d2d10d3

PDB Entry: 2d10 (more details), 2.5 Å

PDB Description: Crystal structure of the Radixin FERM domain complexed with the NHERF-1 C-terminal tail peptide
PDB Compounds: (D:) Radixin

SCOPe Domain Sequences for d2d10d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2d10d3 d.15.1.4 (D:3-87) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
kpinvrvttmdaelefaiqpnttgkqlfdqvvktvglrevwffglqyvdskgystwlkln
kkvtqqdvkkenplqfkfrakffpe

SCOPe Domain Coordinates for d2d10d3:

Click to download the PDB-style file with coordinates for d2d10d3.
(The format of our PDB-style files is described here.)

Timeline for d2d10d3: