| Class b: All beta proteins [48724] (180 folds) |
| Fold b.55: PH domain-like barrel [50728] (3 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) ![]() |
| Family b.55.1.5: Third domain of FERM [50776] (8 proteins) |
| Protein Radixin [50779] (1 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [50780] (9 PDB entries) |
| Domain d2d10b2: 2d10 B:199-297 [131101] Other proteins in same PDB: d2d10a1, d2d10a3, d2d10b1, d2d10b3, d2d10c1, d2d10c3, d2d10d1, d2d10d3 automatically matched to d1gc6a2 |
PDB Entry: 2d10 (more details), 2.5 Å
SCOPe Domain Sequences for d2d10b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2d10b2 b.55.1.5 (B:199-297) Radixin {Mouse (Mus musculus) [TaxId: 10090]}
emygvnyfeiknkkgtelwlgvdalglniyehddkltpkigfpwseirnisfndkkfvik
pidkkapdfvfyaprlrinkrilalcmgnhelymrrrkp
Timeline for d2d10b2: