SCOPe 2.08: Domain d2cvoa1: 2cvo A:68-218,A:384-415

Lineage for d2cvoa1 (2cvo A:68-218,A:384-415)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Putative semialdehyde dehydrogenase [141919] (1 species)

7. Species Rice (Oryza sativa) [TaxId:4530] [141920] (1 PDB entry)
   Uniprot Q6AV34 68-218,384-415

8. Domain d2cvoa1: 2cvo A:68-218,A:384-415 [130877]
   Other proteins in same PDB: d2cvoa2, d2cvob2, d2cvoc2, d2cvod2

Details for d2cvoa1

PDB Entry: 2cvo, 2.2 Å

PDB Description: Crystal structure of putative N-acetyl-gamma-glutamyl-phosphate reductase (AK071544) from rice (Oryza sativa)

PDB Compounds: (A:) putative Semialdehyde dehydrogenase

SCOPe Domain Sequences for d2cvoa1:

Sequence; same for both SEQRES and ATOM records:

>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]}
ksgeevriavlgasgytgaeivrllanhpqfrikvmtadrkageqfgsvfphlitqdlpn
lvavkdadfsnvdavfcclphgttqeiikglpqelkivdlsadfrlrdineyaewyghsh
rapelqqeavygltevlrneirnarlvanpgXlvkgasgqavqnlnlmmglpentglqyq
plfp

Timeline for d2cvoa1:

• d2cvoa1 first appeared in SCOP 1.73
  
• d2cvoa1 appears in SCOPe 2.07