![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
![]() | Protein Putative semialdehyde dehydrogenase [141919] (1 species) |
![]() | Species Rice (Oryza sativa) [TaxId:4530] [141920] (1 PDB entry) Uniprot Q6AV34 68-218,384-415 |
![]() | Domain d2cvod1: 2cvo D:71-218,D:384-415 [130883] Other proteins in same PDB: d2cvoa2, d2cvob2, d2cvoc2, d2cvod2 automated match to d2cvoa1 |
PDB Entry: 2cvo (more details), 2.2 Å
SCOPe Domain Sequences for d2cvod1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cvod1 c.2.1.3 (D:71-218,D:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} eevriavlgasgytgaeivrllanhpqfrikvmtadrkageqfgsvfphlitqdlpnlva vkdadfsnvdavfcclphgttqeiikglpqelkivdlsadfrlrdineyaewyghshrap elqqeavygltevlrneirnarlvanpgXlvkgasgqavqnlnlmmglpentglqyqplf p
Timeline for d2cvod1: