PDB entry 2cvo

View 2cvo on RCSB PDB site
Description: Crystal structure of putative N-acetyl-gamma-glutamyl-phosphate reductase (AK071544) from rice (Oryza sativa)
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2005-06-10, released 2005-12-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative Semialdehyde dehydrogenase
    Species: Oryza sativa [TaxId:4530]
    Gene: AK071544
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6AV34 (Start-365)
      • modified residue (95)
    Domains in SCOPe 2.08: d2cvoa1, d2cvoa2
  • Chain 'B':
    Compound: putative Semialdehyde dehydrogenase
    Species: Oryza sativa [TaxId:4530]
    Gene: AK071544
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6AV34 (Start-365)
      • modified residue (95)
    Domains in SCOPe 2.08: d2cvob1, d2cvob2
  • Chain 'C':
    Compound: putative Semialdehyde dehydrogenase
    Species: Oryza sativa [TaxId:4530]
    Gene: AK071544
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6AV34 (Start-365)
      • modified residue (95)
    Domains in SCOPe 2.08: d2cvoc1, d2cvoc2
  • Chain 'D':
    Compound: putative Semialdehyde dehydrogenase
    Species: Oryza sativa [TaxId:4530]
    Gene: AK071544
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6AV34 (Start-365)
      • modified residue (95)
    Domains in SCOPe 2.08: d2cvod1, d2cvod2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2cvoA (A:)
    asvasspqkqhspktsgvksgeevriavlgasgytgaeivrllanhpqfrikvmtadrka
    geqfgsvfphlitqdlpnlvavkdadfsnvdavfcclphgttqeiikglpqelkivdlsa
    dfrlrdineyaewyghshrapelqqeavygltevlrneirnarlvanpgcyptsiqlplv
    plikaklikvsniiidaksgvsgagrgakeanlyteiaegihaygikghrhvpeieqgls
    eaaeskvtisftpnlicmkrgmqstmfvemapgvtandlyqhlkstyegeefvkllngss
    vphtrhvvgsnycfmnvfedripgraiiisvidnlvkgasgqavqnlnlmmglpentglq
    yqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cvoA (A:)
    ksgeevriavlgasgytgaeivrllanhpqfrikvmtadrkageqfgsvfphlitqdlpn
    lvavkdadfsnvdavfcclphgttqeiikglpqelkivdlsadfrlrdineyaewyghsh
    rapelqqeavygltevlrneirnarlvanpgcyptsiqlplvplikaklikvsniiidak
    sgvsgagrgakeanlyteiaegihaygikghrhvpeieqglseaaeskvtisftpnlicm
    krgmqstmfvemapgvtandlyqhlkstyegeefvkllngssvphtrhvvgsnycfmnvf
    edripgraiiisvidnlvkgasgqavqnlnlmmglpentglqyqplfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2cvoB (B:)
    asvasspqkqhspktsgvksgeevriavlgasgytgaeivrllanhpqfrikvmtadrka
    geqfgsvfphlitqdlpnlvavkdadfsnvdavfcclphgttqeiikglpqelkivdlsa
    dfrlrdineyaewyghshrapelqqeavygltevlrneirnarlvanpgcyptsiqlplv
    plikaklikvsniiidaksgvsgagrgakeanlyteiaegihaygikghrhvpeieqgls
    eaaeskvtisftpnlicmkrgmqstmfvemapgvtandlyqhlkstyegeefvkllngss
    vphtrhvvgsnycfmnvfedripgraiiisvidnlvkgasgqavqnlnlmmglpentglq
    yqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cvoB (B:)
    ksgeevriavlgasgytgaeivrllanhpqfrikvmtadrkageqfgsvfphlitqdlpn
    lvavkdadfsnvdavfcclphgttqeiikglpqelkivdlsadfrlrdineyaewyghsh
    rapelqqeavygltevlrneirnarlvanpgcyptsiqlplvplikaklikvsniiidak
    sgvsgagrgakeanlyteiaegihaygikghrhvpeieqglseaaeskvtisftpnlicm
    krgmqstmfvemapgvtandlyqhlkstyegeefvkllngssvphtrhvvgsnycfmnvf
    edripgraiiisvidnlvkgasgqavqnlnlmmglpentglqyqplfp
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2cvoC (C:)
    asvasspqkqhspktsgvksgeevriavlgasgytgaeivrllanhpqfrikvmtadrka
    geqfgsvfphlitqdlpnlvavkdadfsnvdavfcclphgttqeiikglpqelkivdlsa
    dfrlrdineyaewyghshrapelqqeavygltevlrneirnarlvanpgcyptsiqlplv
    plikaklikvsniiidaksgvsgagrgakeanlyteiaegihaygikghrhvpeieqgls
    eaaeskvtisftpnlicmkrgmqstmfvemapgvtandlyqhlkstyegeefvkllngss
    vphtrhvvgsnycfmnvfedripgraiiisvidnlvkgasgqavqnlnlmmglpentglq
    yqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cvoC (C:)
    ksgeevriavlgasgytgaeivrllanhpqfrikvmtadrkageqfgsvfphlitqdlpn
    lvavkdadfsnvdavfcclphgttqeiikglpqelkivdlsadfrlrdineyaewyghsh
    rapelqqeavygltevlrneirnarlvanpgcyptsiqlplvplikaklikvsniiidak
    sgvsgagrgakeanlyteiaegihaygikghrhvpeieqglseaaeskvtisftpnlicm
    krgmqstmfvemapgvtandlyqhlkstyegeefvkllngssvphtrhvvgsnycfmnvf
    edripgraiiisvidnlvkgasgqavqnlnlmmglpentglqyqplfp
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2cvoD (D:)
    asvasspqkqhspktsgvksgeevriavlgasgytgaeivrllanhpqfrikvmtadrka
    geqfgsvfphlitqdlpnlvavkdadfsnvdavfcclphgttqeiikglpqelkivdlsa
    dfrlrdineyaewyghshrapelqqeavygltevlrneirnarlvanpgcyptsiqlplv
    plikaklikvsniiidaksgvsgagrgakeanlyteiaegihaygikghrhvpeieqgls
    eaaeskvtisftpnlicmkrgmqstmfvemapgvtandlyqhlkstyegeefvkllngss
    vphtrhvvgsnycfmnvfedripgraiiisvidnlvkgasgqavqnlnlmmglpentglq
    yqplfp
    

    Sequence, based on observed residues (ATOM records): (download)
    >2cvoD (D:)
    eevriavlgasgytgaeivrllanhpqfrikvmtadrkageqfgsvfphlitqdlpnlva
    vkdadfsnvdavfcclphgttqeiikglpqelkivdlsadfrlrdineyaewyghshrap
    elqqeavygltevlrneirnarlvanpgcyptsiqlplvplikaklikvsniiidaksgv
    sgagrgakeanlyteiaegihaygikghrhvpeieqglseaaeskvtisftpnlicmkrg
    mqstmfvemapgvtandlyqhlkstyegeefvkllngssvphtrhvvgsnycfmnvfedr
    ipgraiiisvidnlvkgasgqavqnlnlmmglpentglqyqplfp