Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies) core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1 |
Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) N-terminal domain is the classic Rossmann-fold |
Family d.81.1.1: GAPDH-like [55348] (6 proteins) has many additional secondary structures |
Protein Putative semialdehyde dehydrogenase [143540] (1 species) |
Species Rice (Oryza sativa) [TaxId:4530] [143541] (1 PDB entry) Uniprot Q6AV34 219-383 |
Domain d2cvob2: 2cvo B:219-383 [130880] Other proteins in same PDB: d2cvoa1, d2cvob1, d2cvoc1, d2cvod1 automated match to d2cvoa2 |
PDB Entry: 2cvo (more details), 2.2 Å
SCOPe Domain Sequences for d2cvob2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cvob2 d.81.1.1 (B:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} cyptsiqlplvplikaklikvsniiidaksgvsgagrgakeanlyteiaegihaygikgh rhvpeieqglseaaeskvtisftpnlicmkrgmqstmfvemapgvtandlyqhlkstyeg eefvkllngssvphtrhvvgsnycfmnvfedripgraiiisvidn
Timeline for d2cvob2: