Lineage for d2cvoa1 (2cvo A:68-218,A:384-415)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 687227Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 687724Protein Putative semialdehyde dehydrogenase [141919] (1 species)
  7. 687725Species Rice (Oryza sativa) [TaxId:4530] [141920] (1 PDB entry)
  8. 687726Domain d2cvoa1: 2cvo A:68-218,A:384-415 [130877]
    Other proteins in same PDB: d2cvoa2, d2cvob2, d2cvoc2, d2cvod2

Details for d2cvoa1

PDB Entry: 2cvo (more details), 2.2 Å

PDB Description: Crystal structure of putative N-acetyl-gamma-glutamyl-phosphate reductase (AK071544) from rice (Oryza sativa)
PDB Compounds: (A:) putative Semialdehyde dehydrogenase

SCOP Domain Sequences for d2cvoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]}
ksgeevriavlgasgytgaeivrllanhpqfrikvmtadrkageqfgsvfphlitqdlpn
lvavkdadfsnvdavfcclphgttqeiikglpqelkivdlsadfrlrdineyaewyghsh
rapelqqeavygltevlrneirnarlvanpgXlvkgasgqavqnlnlmmglpentglqyq
plfp

SCOP Domain Coordinates for d2cvoa1:

Click to download the PDB-style file with coordinates for d2cvoa1.
(The format of our PDB-style files is described here.)

Timeline for d2cvoa1: