Lineage for d2cdhg1 (2cdh G:17-260)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2841624Protein beta-keto acyl carrier protein reductase [51788] (8 species)
  7. 2841645Species Oil seed rape (Brassica napus) [TaxId:3708] [51789] (2 PDB entries)
  8. 2841647Domain d2cdhg1: 2cdh G:17-260 [130282]
    Other proteins in same PDB: d2cdha1, d2cdha2, d2cdhb1, d2cdhb2, d2cdhc1, d2cdhc2, d2cdhd1, d2cdhd2, d2cdhe1, d2cdhe2, d2cdhf1, d2cdhf2, d2cdhs1
    automatically matched to d1edoa_

Details for d2cdhg1

PDB Entry: 2cdh (more details), 5 Å

PDB Description: architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution.
PDB Compounds: (G:) ketoacyl reductase

SCOPe Domain Sequences for d2cdhg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdhg1 c.2.1.2 (G:17-260) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]}
spvvvvtgasrgigkaialslgkagckvlvnyarsakaaeevskqieayggqaitfggdv
skeadveammktaidawgtidvvvnnagitrdtllirmkksqwdevidlnltgvflctqa
atkimmkkrkgriiniasvvglignigqanyaaakagvigfsktaaregasrninvnvvc
pgfiasdmtaklgedmekkilgtiplgrtgqpenvaglveflalspaasyitgqaftidg
giai

SCOPe Domain Coordinates for d2cdhg1:

Click to download the PDB-style file with coordinates for d2cdhg1.
(The format of our PDB-style files is described here.)

Timeline for d2cdhg1: