SCOPe 2.08: Domain d2cdha2: 2cdh A:254-406

Lineage for d2cdha2 (2cdh A:254-406)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.1: Thiolase-related [53902] (20 proteins)

6. Protein Beta-ketoacyl-ACP synthase I, C-terminal domain [419015] (2 species)

7. Species Escherichia coli [TaxId:562] [419487] (19 PDB entries)
   Uniprot P14926

8. Domain d2cdha2: 2cdh A:254-406 [130271]
   Other proteins in same PDB: d2cdha1, d2cdhb1, d2cdhc1, d2cdhd1, d2cdhe1, d2cdhf1, d2cdhg1, d2cdhh1, d2cdhi1, d2cdhj1, d2cdhk1, d2cdhl1, d2cdhs1
   automatically matched to d1dd8a2

Details for d2cdha2

PDB Entry: 2cdh, 5 Å

PDB Description: architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution.

PDB Compounds: (A:) ketoacyl synthase

SCOPe Domain Sequences for d2cdha2:

Sequence; same for both SEQRES and ATOM records:

>d2cdha2 c.95.1.1 (A:254-406) Beta-ketoacyl-ACP synthase I, C-terminal domain {Escherichia coli [TaxId: 562]}
yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai
revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni
vtettdrelttvmsnsfgfggtnatlvmrklkd

Timeline for d2cdha2:

• d2cdha2 first appeared in SCOP 1.73
  
• d2cdha2 appears in SCOPe 2.07