PDB entry 2cdh

View 2cdh on RCSB PDB site
Description: architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution.
Class: transferase
Keywords: transferase, fatty acid synthesis, multifunctional enzyme, fungal fatty acid synthase
Deposited on 2006-01-24, released 2006-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 5 Å
R-factor: N/A
AEROSPACI score: -0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: enoyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDH (0-225)
  • Chain '1':
    Compound: enoyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDH (0-225)
  • Chain '2':
    Compound: enoyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDH (0-225)
  • Chain '3':
    Compound: enoyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDH (0-225)
  • Chain '4':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain '5':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain '6':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain '7':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain '8':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain '9':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'A':
    Compound: ketoacyl synthase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdha1, d2cdha2
  • Chain 'B':
    Compound: ketoacyl synthase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhb1, d2cdhb2
  • Chain 'C':
    Compound: ketoacyl synthase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhc1, d2cdhc2
  • Chain 'D':
    Compound: ketoacyl synthase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhd1, d2cdhd2
  • Chain 'E':
    Compound: ketoacyl synthase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhe1, d2cdhe2
  • Chain 'F':
    Compound: ketoacyl synthase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhf1, d2cdhf2
  • Chain 'G':
    Compound: ketoacyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhg1
  • Chain 'H':
    Compound: ketoacyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhh1
  • Chain 'I':
    Compound: ketoacyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhi1
  • Chain 'J':
    Compound: ketoacyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhj1
  • Chain 'K':
    Compound: ketoacyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhk1
  • Chain 'L':
    Compound: ketoacyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhl1
  • Chain 'M':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'N':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'O':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'P':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'Q':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'R':
    Compound: malonyl/palmitoyl transferase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'S':
    Compound: dehydratase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Domains in SCOPe 2.07: d2cdhs1
  • Chain 'T':
    Compound: dehydratase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'U':
    Compound: dehydratase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'V':
    Compound: dehydratase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'W':
    Compound: dehydratase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'X':
    Compound: dehydratase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
  • Chain 'Y':
    Compound: enoyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDH (0-225)
  • Chain 'Z':
    Compound: enoyl reductase
    Species: THERMOMYCES LANUGINOSUS [TaxId:5541]
    Database cross-references and differences (RAF-indexed):
    • PDB 2CDH (0-225)

PDB Chain Sequences:

  • Chain '0':
    No sequence available.

  • Chain '1':
    No sequence available.

  • Chain '2':
    No sequence available.

  • Chain '3':
    No sequence available.

  • Chain '4':
    No sequence available.

  • Chain '5':
    No sequence available.

  • Chain '6':
    No sequence available.

  • Chain '7':
    No sequence available.

  • Chain '8':
    No sequence available.

  • Chain '9':
    No sequence available.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhA (A:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhB (B:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhC (C:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhD (D:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhE (E:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhF (F:)
    mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
    drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
    rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
    kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
    eelehalargahiyaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgt
    stpvgdvkelaairevfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsin
    ieeldeqaaglnivtettdrelttvmsnsfgfggtnatlvmrklkd
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhG (G:)
    spvvvvtgasrgigkaialslgkagckvlvnyarsakaaeevskqieayggqaitfggdv
    skeadveammktaidawgtidvvvnnagitrdtllirmkksqwdevidlnltgvflctqa
    atkimmkkrkgriiniasvvglignigqanyaaakagvigfsktaaregasrninvnvvc
    pgfiasdmtaklgedmekkilgtiplgrtgqpenvaglveflalspaasyitgqaftidg
    giai
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhH (H:)
    spvvvvtgasrgigkaialslgkagckvlvnyarsakaaeevskqieayggqaitfggdv
    skeadveammktaidawgtidvvvnnagitrdtllirmkksqwdevidlnltgvflctqa
    atkimmkkrkgriiniasvvglignigqanyaaakagvigfsktaaregasrninvnvvc
    pgfiasdmtaklgedmekkilgtiplgrtgqpenvaglveflalspaasyitgqaftidg
    giai
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhI (I:)
    spvvvvtgasrgigkaialslgkagckvlvnyarsakaaeevskqieayggqaitfggdv
    skeadveammktaidawgtidvvvnnagitrdtllirmkksqwdevidlnltgvflctqa
    atkimmkkrkgriiniasvvglignigqanyaaakagvigfsktaaregasrninvnvvc
    pgfiasdmtaklgedmekkilgtiplgrtgqpenvaglveflalspaasyitgqaftidg
    giai
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhJ (J:)
    spvvvvtgasrgigkaialslgkagckvlvnyarsakaaeevskqieayggqaitfggdv
    skeadveammktaidawgtidvvvnnagitrdtllirmkksqwdevidlnltgvflctqa
    atkimmkkrkgriiniasvvglignigqanyaaakagvigfsktaaregasrninvnvvc
    pgfiasdmtaklgedmekkilgtiplgrtgqpenvaglveflalspaasyitgqaftidg
    giai
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhK (K:)
    spvvvvtgasrgigkaialslgkagckvlvnyarsakaaeevskqieayggqaitfggdv
    skeadveammktaidawgtidvvvnnagitrdtllirmkksqwdevidlnltgvflctqa
    atkimmkkrkgriiniasvvglignigqanyaaakagvigfsktaaregasrninvnvvc
    pgfiasdmtaklgedmekkilgtiplgrtgqpenvaglveflalspaasyitgqaftidg
    giai
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhL (L:)
    spvvvvtgasrgigkaialslgkagckvlvnyarsakaaeevskqieayggqaitfggdv
    skeadveammktaidawgtidvvvnnagitrdtllirmkksqwdevidlnltgvflctqa
    atkimmkkrkgriiniasvvglignigqanyaaakagvigfsktaaregasrninvnvvc
    pgfiasdmtaklgedmekkilgtiplgrtgqpenvaglveflalspaasyitgqaftidg
    giai
    

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cdhS (S:)
    aigqklppfsyayteleaimyalgvgasikdpkdlkfiyegssdfsclptfgviigqksm
    mvlhgeqylelykplpragklkceavvadvlvviimdvysysekelichnqfslflsdkv
    kvavaipnrppdavltdttslnqaalyrlsgdwnplhidpnfaslagfdkpilhglctfg
    fsarrvlqqfadndvsrfkavkarfakpvypgqtlqtemwkegnrihfqtkvqetgdivi
    snayvdla
    

  • Chain 'T':
    No sequence available.

  • Chain 'U':
    No sequence available.

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.

  • Chain 'Y':
    No sequence available.

  • Chain 'Z':
    No sequence available.