Lineage for d2cdhd1 (2cdh D:1-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916579Protein Beta-ketoacyl-ACP synthase I, N-terminal domain [419014] (2 species)
  7. 2916580Species Escherichia coli [TaxId:562] [419486] (19 PDB entries)
    Uniprot P14926
  8. 2916654Domain d2cdhd1: 2cdh D:1-253 [130276]
    Other proteins in same PDB: d2cdha2, d2cdhb2, d2cdhc2, d2cdhd2, d2cdhe2, d2cdhf2, d2cdhg1, d2cdhh1, d2cdhi1, d2cdhj1, d2cdhk1, d2cdhl1, d2cdhs1
    automatically matched to d1dd8a1
    has additional insertions and/or extensions that are not grouped together

Details for d2cdhd1

PDB Entry: 2cdh (more details), 5 Å

PDB Description: architecture of the thermomyces lanuginosus fungal fatty acid synthase at 5 angstrom resolution.
PDB Compounds: (D:) ketoacyl synthase

SCOPe Domain Sequences for d2cdhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cdhd1 c.95.1.1 (D:1-253) Beta-ketoacyl-ACP synthase I, N-terminal domain {Escherichia coli [TaxId: 562]}
mkrvvitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

SCOPe Domain Coordinates for d2cdhd1:

Click to download the PDB-style file with coordinates for d2cdhd1.
(The format of our PDB-style files is described here.)

Timeline for d2cdhd1: