![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.1: Thiolase-related [53902] (20 proteins) |
![]() | Protein Beta-ketoacyl-ACP synthase I, C-terminal domain [419015] (2 species) |
![]() | Species Escherichia coli [TaxId:562] [419487] (19 PDB entries) Uniprot P14926 |
![]() | Domain d2cdhd2: 2cdh D:254-406 [130277] Other proteins in same PDB: d2cdha1, d2cdhb1, d2cdhc1, d2cdhd1, d2cdhe1, d2cdhf1, d2cdhg1, d2cdhh1, d2cdhi1, d2cdhj1, d2cdhk1, d2cdhl1, d2cdhs1 automatically matched to d1dd8a2 |
PDB Entry: 2cdh (more details), 5 Å
SCOPe Domain Sequences for d2cdhd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cdhd2 c.95.1.1 (D:254-406) Beta-ketoacyl-ACP synthase I, C-terminal domain {Escherichia coli [TaxId: 562]} yaeivgygatsdgadmvapsgegavrcmkmamhgvdtpidylnshgtstpvgdvkelaai revfgdkspaisatkamtghslgaagvqeaiysllmlehgfiapsinieeldeqaaglni vtettdrelttvmsnsfgfggtnatlvmrklkd
Timeline for d2cdhd2: