Lineage for d2c2ld1 (2c2l D:24-224)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2726649Superfamily a.118.8: TPR-like [48452] (11 families) (S)
  5. 2726650Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2726785Protein STIP1 homology and U box-containing protein 1, STUB1 [140837] (1 species)
  7. 2726786Species Mouse (Mus musculus) [TaxId:10090] [140838] (1 PDB entry)
    Uniprot Q9WUD1 24-224
  8. 2726790Domain d2c2ld1: 2c2l D:24-224 [129678]
    Other proteins in same PDB: d2c2la2, d2c2lb2, d2c2lc2, d2c2ld2
    automatically matched to 2C2L A:24-224
    complexed with ni, so4

    has additional insertions and/or extensions that are not grouped together

Details for d2c2ld1

PDB Entry: 2c2l (more details), 3.3 Å

PDB Description: crystal structure of the chip u-box e3 ubiquitin ligase
PDB Compounds: (D:) carboxy terminus of hsp70-interacting protein

SCOPe Domain Sequences for d2c2ld1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2ld1 a.118.8.1 (D:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
khdkymadmdelfsqvdekrk

SCOPe Domain Coordinates for d2c2ld1:

Click to download the PDB-style file with coordinates for d2c2ld1.
(The format of our PDB-style files is described here.)

Timeline for d2c2ld1: