![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies) multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix |
![]() | Superfamily a.118.8: TPR-like [48452] (11 families) ![]() |
![]() | Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins) this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain |
![]() | Protein STIP1 homology and U box-containing protein 1, STUB1 [140837] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [140838] (1 PDB entry) Uniprot Q9WUD1 24-224 |
![]() | Domain d2c2la1: 2c2l A:24-224 [129672] Other proteins in same PDB: d2c2la2, d2c2lb2, d2c2lc2, d2c2ld2 includes linker region 157-224 that forms an alpha hairpin dimerisation subdomain complexed with ni, so4 has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2c2l (more details), 3.3 Å
SCOPe Domain Sequences for d2c2la1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea khdkymadmdelfsqvdekrk
Timeline for d2c2la1: