Lineage for d2c2la2 (2c2l A:225-304)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3037528Fold g.44: RING/U-box [57849] (1 superfamily)
    dimetal(zinc)-bound alpha+beta motif; structurally diverse
  4. 3037529Superfamily g.44.1: RING/U-box [57850] (7 families) (S)
  5. 3037595Family g.44.1.2: U-box [90222] (5 proteins)
    Associated with multi-ubiquitination; lacks the RING-domain metal ion-binding residues
  6. 3037607Protein STIP1 homology and U box-containing protein 1, STUB1 [144224] (1 species)
  7. 3037608Species Mouse (Mus musculus) [TaxId:10090] [144225] (2 PDB entries)
    Uniprot Q9WUD1 225-304! Uniprot Q9WUD1 227-301
  8. 3037610Domain d2c2la2: 2c2l A:225-304 [129673]
    Other proteins in same PDB: d2c2la1, d2c2lb1, d2c2lc1, d2c2ld1
    complexed with ni, so4

Details for d2c2la2

PDB Entry: 2c2l (more details), 3.3 Å

PDB Description: crystal structure of the chip u-box e3 ubiquitin ligase
PDB Compounds: (A:) carboxy terminus of hsp70-interacting protein

SCOPe Domain Sequences for d2c2la2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
krdipdylcgkisfelmrepcitpsgitydrkdieehlqrvghfnpvtrspltqeqlipn
lamkevidafisengwvedy

SCOPe Domain Coordinates for d2c2la2:

Click to download the PDB-style file with coordinates for d2c2la2.
(The format of our PDB-style files is described here.)

Timeline for d2c2la2: