SCOPe 2.08: Domain d2c2lc1: 2c2l C:24-224

Lineage for d2c2lc1 (2c2l C:24-224)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.8: TPR-like [48452] (11 families)

5. Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (21 proteins)
   this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain

6. Protein STIP1 homology and U box-containing protein 1, STUB1 [140837] (1 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140838] (1 PDB entry)
   Uniprot Q9WUD1 24-224

8. Domain d2c2lc1: 2c2l C:24-224 [129676]
   Other proteins in same PDB: d2c2la2, d2c2lb2, d2c2lc2, d2c2ld2
   automatically matched to 2C2L A:24-224
   complexed with ni, so4
   has additional insertions and/or extensions that are not grouped together

Details for d2c2lc1

PDB Entry: 2c2l, 3.3 Å

PDB Description: crystal structure of the chip u-box e3 ubiquitin ligase

PDB Compounds: (C:) carboxy terminus of hsp70-interacting protein

SCOPe Domain Sequences for d2c2lc1:

Sequence; same for both SEQRES and ATOM records:

>d2c2lc1 a.118.8.1 (C:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
khdkymadmdelfsqvdekrk

Timeline for d2c2lc1:

• d2c2lc1 first appeared in SCOP 1.73
  
• d2c2lc1 appears in SCOPe 2.07