PDB entry 2c2l

View 2c2l on RCSB PDB site
Description: crystal structure of the chip u-box e3 ubiquitin ligase
Class: chaperone
Keywords: chaperone, e3 ligase, ubiquitinylation, tpr, heat-shock protein complex
Deposited on 2005-09-29, released 2005-11-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.2475
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: carboxy terminus of hsp70-interacting protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c2la1, d2c2la2
  • Chain 'B':
    Compound: carboxy terminus of hsp70-interacting protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c2lb1, d2c2lb2
  • Chain 'C':
    Compound: carboxy terminus of hsp70-interacting protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c2lc1, d2c2lc2
  • Chain 'D':
    Compound: carboxy terminus of hsp70-interacting protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2c2ld1, d2c2ld2
  • Chain 'E':
    Compound: hsp90
    Database cross-references and differences (RAF-indexed):
    • PDB 2C2L (0-8)
  • Chain 'F':
    Compound: hsp90
    Database cross-references and differences (RAF-indexed):
    • PDB 2C2L (0-8)
  • Chain 'G':
    Compound: hsp90
    Database cross-references and differences (RAF-indexed):
    • PDB 2C2L (0-8)
  • Chain 'H':
    Compound: hsp90
    Database cross-references and differences (RAF-indexed):
    • PDB 2C2L (0-8)
  • Heterogens: SO4, NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c2lA (A:)
    spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
    crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
    kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
    khdkymadmdelfsqvdekrkkrdipdylcgkisfelmrepcitpsgitydrkdieehlq
    rvghfnpvtrspltqeqlipnlamkevidafisengwvedy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c2lB (B:)
    spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
    crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
    kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
    khdkymadmdelfsqvdekrkkrdipdylcgkisfelmrepcitpsgitydrkdieehlq
    rvghfnpvtrspltqeqlipnlamkevidafisengwvedy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c2lC (C:)
    spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
    crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
    kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
    khdkymadmdelfsqvdekrkkrdipdylcgkisfelmrepcitpsgitydrkdieehlq
    rvghfnpvtrspltqeqlipnlamkevidafisengwvedy
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2c2lD (D:)
    spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
    crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
    kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
    khdkymadmdelfsqvdekrkkrdipdylcgkisfelmrepcitpsgitydrkdieehlq
    rvghfnpvtrspltqeqlipnlamkevidafisengwvedy
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.