![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
![]() | Protein Elongation factor Tu (EF-Tu), N-terminal (G) domain [52626] (4 species) |
![]() | Species Escherichia coli [TaxId:562] [52627] (11 PDB entries) Uniprot P02990 |
![]() | Domain d2bvna3: 2bvn A:9-204 [129284] Other proteins in same PDB: d2bvna1, d2bvna2, d2bvnb1, d2bvnb2 automated match to d1efca3 complexed with enx, gnp, mg |
PDB Entry: 2bvn (more details), 2.3 Å
SCOPe Domain Sequences for d2bvna3:
Sequence, based on SEQRES records: (download)
>d2bvna3 c.37.1.8 (A:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]} kphvnvgtighvdhgkttltaaittvlaktyggaarafdqidnapeekargitintshve ydtptrhyahvdcpghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvp yiivflnkcdmvddeellelvemevrellsqydfpgddtpivrgsalkalegdaeweaki lelagfldsyipeper
>d2bvna3 c.37.1.8 (A:9-204) Elongation factor Tu (EF-Tu), N-terminal (G) domain {Escherichia coli [TaxId: 562]} kphvnvgtighvdhgkttltaaittvlaktyggekargitintshveydtptrhyahvdc pghadyvknmitgaaqmdgailvvaatdgpmpqtrehillgrqvgvpyiivflnkcdmvd deellelvemevrellsqydfpgddtpivrgsalkalegdaeweakilelagfldsyipe per
Timeline for d2bvna3: