Lineage for d2bvnb2 (2bvn B:297-393)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (7 proteins)
  6. Protein Elongation factor Tu (EF-Tu) [50467] (4 species)
  7. Species Escherichia coli [TaxId:562] [50468] (9 PDB entries)
    Uniprot P02990
  8. Domain d2bvnb2: 2bvn B:297-393 [129286]
    Other proteins in same PDB: d2bvna1, d2bvna3, d2bvnb1, d2bvnb3
    automated match to d1efca2
    complexed with enx, gnp, mg

Details for d2bvnb2

PDB Entry: 2bvn (more details), 2.3 Å

PDB Description: e. coli ef-tu:gdpnp in complex with the antibiotic enacyloxin iia
PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d2bvnb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvnb2 b.44.1.1 (B:297-393) Elongation factor Tu (EF-Tu) {Escherichia coli [TaxId: 562]}
tikphtkfesevyilskdeggrhtpffkgyrpqfyfrttdvtgtielpegvemvmpgdni
kmvvtlihpiamddglrfaireggrtvgagvvakvls

SCOPe Domain Coordinates for d2bvnb2 are not available.

Timeline for d2bvnb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bvnb1, d2bvnb3
View in 3D
Domains from other chains:
(mouse over for more information)
d2bvna1, d2bvna2, d2bvna3