SCOPe 2.08: Domain d2bvnb1: 2bvn B:205-296

Lineage for d2bvnb1 (2bvn B:205-296)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.3: Translation proteins [50447] (7 families)

5. Family b.43.3.1: Elongation factors [50448] (11 proteins)

6. Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
   N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology

7. Species Escherichia coli [TaxId:562] [50450] (9 PDB entries)
   Uniprot P02990

8. Domain d2bvnb1: 2bvn B:205-296 [129285]
   Other proteins in same PDB: d2bvna2, d2bvna3, d2bvnb2, d2bvnb3
   automated match to d1efca1
   complexed with enx, gnp, mg

Details for d2bvnb1

PDB Entry: 2bvn, 2.3 Å

PDB Description: e. coli ef-tu:gdpnp in complex with the antibiotic enacyloxin iia

PDB Compounds: (B:) elongation factor tu

SCOPe Domain Sequences for d2bvnb1:

Sequence; same for both SEQRES and ATOM records:

>d2bvnb1 b.43.3.1 (B:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

Timeline for d2bvnb1:

• d2bvnb1 first appeared in SCOP 1.73
  
• d2bvnb1 appears in SCOPe 2.07