Lineage for d2bvna1 (2bvn A:205-296)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792984Superfamily b.43.3: Translation proteins [50447] (7 families) (S)
  5. 2792985Family b.43.3.1: Elongation factors [50448] (11 proteins)
  6. 2793069Protein Elongation factor Tu (EF-Tu), domain 2 [50449] (4 species)
    N-terminal domain is related to G proteins; C-terminal domain is (6,10) barrel of circularly permuted topology
  7. 2793076Species Escherichia coli [TaxId:562] [50450] (9 PDB entries)
    Uniprot P02990
  8. 2793083Domain d2bvna1: 2bvn A:205-296 [129282]
    Other proteins in same PDB: d2bvna2, d2bvna3, d2bvnb2, d2bvnb3
    automated match to d1efca1
    complexed with enx, gnp, mg

Details for d2bvna1

PDB Entry: 2bvn (more details), 2.3 Å

PDB Description: e. coli ef-tu:gdpnp in complex with the antibiotic enacyloxin iia
PDB Compounds: (A:) elongation factor tu

SCOPe Domain Sequences for d2bvna1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bvna1 b.43.3.1 (A:205-296) Elongation factor Tu (EF-Tu), domain 2 {Escherichia coli [TaxId: 562]}
aidkpfllpiedvfsisgrgtvvtgrvergiikvgeeveivgiketqkstctgvemfrkl
ldegragenvgvllrgikreeiergqvlakpg

SCOPe Domain Coordinates for d2bvna1:

Click to download the PDB-style file with coordinates for d2bvna1.
(The format of our PDB-style files is described here.)

Timeline for d2bvna1: