SCOPe 2.08: Domain d2bkbc1: 2bkb C:1-82

Lineage for d2bkbc1 (2bkb C:1-82)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)

6. Protein automated matches [227044] (4 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255056] (1 PDB entry)

8. Domain d2bkbc1: 2bkb C:1-82 [128671]
   Other proteins in same PDB: d2bkba2, d2bkbb2, d2bkbc2, d2bkbd2
   automated match to d1isca1
   complexed with fe2

Details for d2bkbc1

PDB Entry: 2bkb, 1.7 Å

PDB Description: q69e-fesod

PDB Compounds: (C:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2bkbc1:

Sequence; same for both SEQRES and ATOM records:

>d2bkbc1 a.2.11.1 (C:1-82) automated matches {Escherichia coli [TaxId: 562]}
sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
ggvfnnaaevwnhtfywnclap

Timeline for d2bkbc1:

• d2bkbc1 first appeared in SCOP 1.73
  
• d2bkbc1 appears in SCOPe 2.07