![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins) |
![]() | Protein automated matches [227044] (4 species) not a true protein |
![]() | Domain d2bkbc1: 2bkb C:1-82 [128671] Other proteins in same PDB: d2bkba2, d2bkbb2, d2bkbc2, d2bkbd2 automated match to d1isca1 complexed with fe2 |
PDB Entry: 2bkb (more details), 1.7 Å
SCOPe Domain Sequences for d2bkbc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkbc1 a.2.11.1 (C:1-82) automated matches {Escherichia coli [TaxId: 562]} sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse ggvfnnaaevwnhtfywnclap
Timeline for d2bkbc1: