Lineage for d2bkba1 (2bkb A:1-82)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
  6. Protein automated matches [227044] (4 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [255056] (1 PDB entry)
  8. Domain d2bkba1: 2bkb A:1-82 [128667]
    Other proteins in same PDB: d2bkba2, d2bkbb2, d2bkbc2, d2bkbd2
    automated match to d1isca1
    complexed with fe2

Details for d2bkba1

PDB Entry: 2bkb (more details), 1.7 Å

PDB Description: q69e-fesod
PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2bkba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkba1 a.2.11.1 (A:1-82) automated matches {Escherichia coli [TaxId: 562]}
sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
ggvfnnaaevwnhtfywnclap

SCOPe Domain Coordinates for d2bkba1 are not available.

Timeline for d2bkba1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bkba2
View in 3D
Domains from other chains:
(mouse over for more information)
d2bkbb1, d2bkbb2, d2bkbc1, d2bkbc2, d2bkbd1, d2bkbd2