SCOPe 2.08: Domain d2bkbd1: 2bkb D:201-282

Lineage for d2bkbd1 (2bkb D:201-282)

Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds)
Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
2 helices; antiparallel hairpin, left-handed twist
Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
automatically mapped to Pfam PF00081
Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (4 proteins)
Protein automated matches [227044] (4 species)
not a true protein
Species Escherichia coli [TaxId:562] [255056] (1 PDB entry)
Domain d2bkbd1: 2bkb D:201-282 [128673]
Other proteins in same PDB: d2bkba2, d2bkbb2, d2bkbc2, d2bkbd2
automated match to d1isca1
complexed with fe2

Details for d2bkbd1

PDB Entry: 2bkb (more details), 1.7 Å

PDB Description: q69e-fesod

PDB Compounds: (D:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2bkbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkbd1 a.2.11.1 (D:201-282) automated matches {Escherichia coli [TaxId: 562]}
sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
ggvfnnaaevwnhtfywnclap

SCOPe Domain Coordinates for d2bkbd1:

Click to download the PDB-style file with coordinates for d2bkbd1.
(The format of our PDB-style files is described here.)

Timeline for d2bkbd1: