PDB entry 2bkb

View 2bkb on RCSB PDB site
Description: q69e-fesod
Class: oxidoreductase
Keywords: superoxide dismutase, iron redox tuning, h-bond network, mutant, oxidoreductase
Deposited on 2005-02-14, released 2007-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.207
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: superoxide dismutase [fe]
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGD3
      • engineered mutation (68)
    Domains in SCOPe 2.07: d2bkba1, d2bkba2
  • Chain 'B':
    Compound: superoxide dismutase [fe]
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGD3 (0-191)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d2bkbb1, d2bkbb2
  • Chain 'C':
    Compound: superoxide dismutase [fe]
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGD3
      • engineered mutation (68)
    Domains in SCOPe 2.07: d2bkbc1, d2bkbc2
  • Chain 'D':
    Compound: superoxide dismutase [fe]
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0AGD3 (0-191)
      • engineered mutation (68)
    Domains in SCOPe 2.07: d2bkbd1, d2bkbd2
  • Heterogens: FE2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bkbA (A:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaevwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bkbB (B:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaevwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bkbC (C:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaevwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bkbD (D:)
    sfelpalpyakdalaphisaetieyhygkhhqtyvtnlnnlikgtafegksleeiirsse
    ggvfnnaaevwnhtfywnclapnaggeptgkvaeaiaasfgsfadfkaqftdaaiknfgs
    gwtwlvknsdgklaivstsnagtplttdatplltvdvwehayyidyrnarpgylehfwal
    vnwefvaknlaa