Lineage for d2bkbd2 (2bkb D:283-392)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) 
automatically mapped to Pfam PF02777Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) 
Protein automated matches [226880] (5 species)
not a true protein- Species Escherichia coli [TaxId:562] [255057] (1 PDB entry)
Domain d2bkbd2: 2bkb D:283-392 [128674]
Other proteins in same PDB: d2bkba1, d2bkbb1, d2bkbc1, d2bkbd1
automated match to d2nyba2
complexed with fe2
Details for d2bkbd2
PDB Entry: 2bkb (more details), 1.7 Å
PDB Description: q69e-fesod
PDB Compounds: (D:) superoxide dismutase [fe]SCOPe Domain Sequences for d2bkbd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkbd2 d.44.1.1 (D:283-392) automated matches {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa
SCOPe Domain Coordinates for d2bkbd2:
Click to download the PDB-style file with coordinates for d2bkbd2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2bkbd2:
- d2bkbd2 first appeared in SCOP 1.73
- d2bkbd2 appears in SCOPe 2.07
View in 3D
