Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) automatically mapped to Pfam PF02777 |
Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins) |
Protein automated matches [226880] (5 species) not a true protein |
Domain d2bkbc2: 2bkb C:83-192 [128672] Other proteins in same PDB: d2bkba1, d2bkbb1, d2bkbc1, d2bkbd1 automated match to d2nyba2 complexed with fe2 |
PDB Entry: 2bkb (more details), 1.7 Å
SCOPe Domain Sequences for d2bkbc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkbc2 d.44.1.1 (C:83-192) automated matches {Escherichia coli [TaxId: 562]} naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa
Timeline for d2bkbc2: