Lineage for d2bkbc2 (2bkb C:83-192)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)
  6. Protein automated matches [226880] (5 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [255057] (1 PDB entry)
  8. Domain d2bkbc2: 2bkb C:83-192 [128672]
    Other proteins in same PDB: d2bkba1, d2bkbb1, d2bkbc1, d2bkbd1
    automated match to d2nyba2
    complexed with fe2

Details for d2bkbc2

PDB Entry: 2bkb (more details), 1.7 Å

PDB Description: q69e-fesod
PDB Compounds: (C:) superoxide dismutase [fe]

SCOPe Domain Sequences for d2bkbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkbc2 d.44.1.1 (C:83-192) automated matches {Escherichia coli [TaxId: 562]}
naggeptgkvaeaiaasfgsfadfkaqftdaaiknfgsgwtwlvknsdgklaivstsnag
tplttdatplltvdvwehayyidyrnarpgylehfwalvnwefvaknlaa

SCOPe Domain Coordinates for d2bkbc2 are not available.

Timeline for d2bkbc2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bkbc1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bkba1, d2bkba2, d2bkbb1, d2bkbb2, d2bkbd1, d2bkbd2