SCOPe 2.08: Domain d2bcjq1: 2bcj Q:67-183

Lineage for d2bcjq1 (2bcj Q:67-183)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [140674] (5 PDB entries)
   Uniprot P21279 67-183! Uniprot P27600 82-203! Uniprot P27601 76-201

8. Domain d2bcjq1: 2bcj Q:67-183 [128291]
   Other proteins in same PDB: d2bcja1, d2bcja2, d2bcja3, d2bcjb_, d2bcjg_, d2bcjq2
   G alpha-q
   complexed with alf, gdp, mg

Details for d2bcjq1

PDB Entry: 2bcj, 3.06 Å

PDB Description: crystal structure of g protein-coupled receptor kinase 2 in complex with galpha-q and gbetagamma subunits

PDB Compounds: (Q:) Guanine nucleotide-binding protein G(i) subunit alpha-1, Guanine nucleotide-binding protein G(q) subunit alpha chimera

SCOPe Domain Sequences for d2bcjq1:

Sequence; same for both SEQRES and ATOM records:

>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]}
ysdedkrgftklvyqniftamqamiramdtlkipykyehnkahaqlvrevdvekvsafen
pyvdaikslwndpgiqecydrrreyqlsdstkyylndldrvadpsylptqqdvlrvr

Timeline for d2bcjq1:

• d2bcjq1 first appeared in SCOP 1.73
  
• d2bcjq1 appears in SCOPe 2.07