Class a: All alpha proteins [46456] (258 folds) |
Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily) 5 helices; folded leaf |
Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family) this domain interrupts the G-protein common fold |
Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein) |
Protein Transducin (alpha subunit), insertion domain [47897] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [140674] (3 PDB entries) |
Domain d2bcjq1: 2bcj Q:67-183 [128291] Other proteins in same PDB: d2bcja1, d2bcja2, d2bcja3, d2bcjb1, d2bcjg1, d2bcjq2 G alpha-q complexed with ace, alf, gdp, mg; mutant |
PDB Entry: 2bcj (more details), 3.06 Å
SCOP Domain Sequences for d2bcjq1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bcjq1 a.66.1.1 (Q:67-183) Transducin (alpha subunit), insertion domain {Mouse (Mus musculus) [TaxId: 10090]} ysdedkrgftklvyqniftamqamiramdtlkipykyehnkahaqlvrevdvekvsafen pyvdaikslwndpgiqecydrrreyqlsdstkyylndldrvadpsylptqqdvlrvr
Timeline for d2bcjq1: